![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein D-Amino acid amidase DaaA [144038] (1 species) |
![]() | Species Ochrobactrum anthropi [TaxId:529] [144039] (6 PDB entries) Uniprot Q9LCC8 2-363 |
![]() | Domain d2efxc_: 2efx C: [132117] automated match to d2dnsa1 complexed with ba, nfa |
PDB Entry: 2efx (more details), 2.2 Å
SCOPe Domain Sequences for d2efxc_:
Sequence, based on SEQRES records: (download)
>d2efxc_ e.3.1.1 (C:) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]} dlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasct ksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisd kswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplg mkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsganaa gdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygss elkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsr s
>d2efxc_ e.3.1.1 (C:) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]} dlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasct ksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisd kswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplg mkdtwvgthetfpiereargymhadenpqwdvsgagdpvdgvwdstewfplsganaagdm vstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygsselk ghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsrs
Timeline for d2efxc_: