Lineage for d2efta2 (2eft A:175-317)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. 2917122Protein Ketoacyl-ACP synthase III (FabH) [53912] (5 species)
  7. 2917126Species Escherichia coli [TaxId:562] [53913] (14 PDB entries)
  8. 2917144Domain d2efta2: 2eft A:175-317 [132106]
    automated match to d1hnja2
    complexed with coa, mee, so4

Details for d2efta2

PDB Entry: 2eft (more details), 2 Å

PDB Description: Methanethiol-CYS 112 inhibition complex of E. coli ketoacyl synthase III (FABH) and Coenzyme A (high concentration (1.7mM) soak)
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d2efta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2efta2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]}
isthlhadgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannld
rsqldwlvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrik
pgqlvlleafgggftwgsalvrf

SCOPe Domain Coordinates for d2efta2:

Click to download the PDB-style file with coordinates for d2efta2.
(The format of our PDB-style files is described here.)

Timeline for d2efta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2efta1