SCOP 1.73: Domain d2ecca1: 2ecc A:1-76

Lineage for d2ecca1 (2ecc A:1-76)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (17 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (39 proteins)
   Pfam PF00046

6. Protein Homeobox-leucine zipper protein Homez [116778] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116779] (1 PDB entry)
   Structural genomics target

8. Domain d2ecca1: 2ecc A:1-76 [132104]
   automatically matched to d1wjha_

Details for d2ecca1

PDB Entry: 2ecc

PDB Description: solution structure of the second homeobox domain of human homeodomain leucine zipper-encoding gene (homez)

PDB Compounds: (A:) Homeobox and leucine zipper protein Homez

SCOP Domain Sequences for d2ecca1:

Sequence; same for both SEQRES and ATOM records:

>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]}
gssgssgkrktkeqlailksfflqcqwarredyqkleqitglprpeiiqwfgdtryalkh
gqlkwfrdnasgpssg

Timeline for d2ecca1:

• d2ecca1 is new in SCOP 1.73
  
• d2ecca1 appears in SCOP 1.75
  
• d2ecca1 appears in the current release, SCOPe 2.08, called d2ecca2