Class a: All alpha proteins [46456] (258 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (17 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (39 proteins) Pfam PF00046 |
Protein Homeobox-leucine zipper protein Homez [116778] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [116779] (1 PDB entry) Structural genomics target |
Domain d2ecca1: 2ecc A:1-76 [132104] automatically matched to d1wjha_ |
PDB Entry: 2ecc (more details)
SCOP Domain Sequences for d2ecca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} gssgssgkrktkeqlailksfflqcqwarredyqkleqitglprpeiiqwfgdtryalkh gqlkwfrdnasgpssg
Timeline for d2ecca1: