Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein Homeobox-leucine zipper protein Homez [116778] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [116779] (1 PDB entry) Uniprot Q8IX15 337-399 Structural genomics target |
Domain d2ecca2: 2ecc A:8-70 [132104] Other proteins in same PDB: d2ecca3, d2ecca4 automated match to d2ecca1 |
PDB Entry: 2ecc (more details)
SCOPe Domain Sequences for d2ecca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ecca2 a.4.1.1 (A:8-70) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} krktkeqlailksfflqcqwarredyqkleqitglprpeiiqwfgdtryalkhgqlkwfr dna
Timeline for d2ecca2: