Lineage for d2ecca2 (2ecc A:8-70)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691859Protein Homeobox-leucine zipper protein Homez [116778] (1 species)
  7. 2691860Species Human (Homo sapiens) [TaxId:9606] [116779] (1 PDB entry)
    Uniprot Q8IX15 337-399
    Structural genomics target
  8. 2691861Domain d2ecca2: 2ecc A:8-70 [132104]
    Other proteins in same PDB: d2ecca3, d2ecca4
    automated match to d2ecca1

Details for d2ecca2

PDB Entry: 2ecc (more details)

PDB Description: solution structure of the second homeobox domain of human homeodomain leucine zipper-encoding gene (homez)
PDB Compounds: (A:) Homeobox and leucine zipper protein Homez

SCOPe Domain Sequences for d2ecca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ecca2 a.4.1.1 (A:8-70) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]}
krktkeqlailksfflqcqwarredyqkleqitglprpeiiqwfgdtryalkhgqlkwfr
dna

SCOPe Domain Coordinates for d2ecca2:

Click to download the PDB-style file with coordinates for d2ecca2.
(The format of our PDB-style files is described here.)

Timeline for d2ecca2: