Lineage for d2e99a_ (2e99 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919043Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 2919044Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 2919045Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
    automatically mapped to Pfam PF01255
  6. 2919088Protein automated matches [190121] (4 species)
    not a true protein
  7. 2919092Species Escherichia coli [TaxId:562] [186844] (9 PDB entries)
  8. 2919098Domain d2e99a_: 2e99 A: [132096]
    automated match to d1jp3a_
    complexed with b08

Details for d2e99a_

PDB Entry: 2e99 (more details), 2 Å

PDB Description: E. coli undecaprenyl pyrophosphate synthase in complex with BPH-608
PDB Compounds: (A:) Undecaprenyl pyrophosphate synthetase

SCOPe Domain Sequences for d2e99a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e99a_ c.101.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
pahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsse
nwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtag
ntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvi
rtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre

SCOPe Domain Coordinates for d2e99a_:

Click to download the PDB-style file with coordinates for d2e99a_.
(The format of our PDB-style files is described here.)

Timeline for d2e99a_: