SCOP 1.73: Domain d2e98b1: 2e98 B:17-240

Lineage for d2e98b1 (2e98 B:17-240)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (1 family)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (1 protein)

6. Protein Undecaprenyl diphosphate synthase [64007] (2 species)

7. Species Escherichia coli [TaxId:562] [64009] (10 PDB entries)

8. Domain d2e98b1: 2e98 B:17-240 [132095]
   automatically matched to d1jp3a_
   complexed with b29

Details for d2e98b1

PDB Entry: 2e98, 1.9 Å

PDB Description: E. coli undecaprenyl pyrophosphate synthase in complex with BPH-629

PDB Compounds: (B:) Undecaprenyl pyrophosphate synthetase

SCOP Domain Sequences for d2e98b1:

Sequence, based on SEQRES records:

>d2e98b1 c.101.1.1 (B:17-240) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssenwn
rpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntg
ltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtg
gehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre

Sequence, based on observed residues (ATOM records):

>d2e98b1 c.101.1.1 (B:17-240) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsssalm
elfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyg
grwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfll
wqiayaelyftdvlwpdfdeqdfegalnafanre

Timeline for d2e98b1:

• d2e98b1 is new in SCOP 1.73
  
• d2e98b1 appears in SCOP 1.75
  
• d2e98b1 appears in the current release, SCOPe 2.08, called d2e98b_