SCOPe 2.04: Domain d2e80a_: 2e80 A:

Lineage for d2e80a_ (2e80 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein automated matches [190276] (9 species)
   not a true protein

7. Species Wolinella succinogenes [TaxId:273121] [187068] (2 PDB entries)

8. Domain d2e80a_: 2e80 A: [132092]
   automated match to d1fs7a_
   complexed with act, ca, hem, no2, yt3

Details for d2e80a_

PDB Entry: 2e80, 1.6 Å

PDB Description: cytochrome c nitrite reductase from wolinella succinogenes with bound substrate nitrite

PDB Compounds: (A:) Cytochrome c-552

SCOPe Domain Sequences for d2e80a_:

Sequence; same for both SEQRES and ATOM records:

>d2e80a_ a.138.1.3 (A:) automated matches {Wolinella succinogenes [TaxId: 273121]}
ktahsqgiegkamseewaryyprqfdswkktkesdnitdmlkekpalvvawagypfskdy
naprghyyalqdnintlrtgapvdgktgplpsacwtckspdvpriieqdgeleyftgkwa
kygdeivntigcynchddksaelkskvpyldrglsaagfktfaesthqekrslvcaqchv
eyyfkktewkddkgvdktamvvtlpwskgisteqmeayydeinfadwthgisktpmlkaq
hpdwelyktgihgqkgvscadchmpytqegavkysdhkvgnpldnmdkscmnchreseqk
lkdivkqkferkeflqdiafdnigkahletgkamelgatdaelkeirthirhaqwradma
iaghgsffhapeevlrllasgneeaqkariklvkvlakygaidyvapdfetkekaqklak
vdmeafiaeklkfkqtleqewkkqaiakgrlnpeslkgvdekssyydktkk

Timeline for d2e80a_:

• d2e80a_ first appeared in SCOP 1.73, called d2e80a1
  
• d2e80a_ appears in SCOPe 2.03
  
• d2e80a_ appears in SCOPe 2.05
  
• d2e80a_ appears in the current release, SCOPe 2.08