SCOP 1.73: Domain d2e80a1: 2e80 A:37-507

Lineage for d2e80a1 (2e80 A:37-507)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Cytochrome c nitrite reductase [48718] (4 species)

7. Species Wolinella succinogenes [TaxId:844] [48720] (5 PDB entries)

8. Domain d2e80a1: 2e80 A:37-507 [132092]
   automatically matched to d1fs7a_
   complexed with act, ca, hem, no2, yt3

Details for d2e80a1

PDB Entry: 2e80, 1.6 Å

PDB Description: cytochrome c nitrite reductase from wolinella succinogenes with bound substrate nitrite

PDB Compounds: (A:) Cytochrome c-552

SCOP Domain Sequences for d2e80a1:

Sequence; same for both SEQRES and ATOM records:

>d2e80a1 a.138.1.3 (A:37-507) Cytochrome c nitrite reductase {Wolinella succinogenes [TaxId: 844]}
ktahsqgiegkamseewaryyprqfdswkktkesdnitdmlkekpalvvawagypfskdy
naprghyyalqdnintlrtgapvdgktgplpsacwtckspdvpriieqdgeleyftgkwa
kygdeivntigcynchddksaelkskvpyldrglsaagfktfaesthqekrslvcaqchv
eyyfkktewkddkgvdktamvvtlpwskgisteqmeayydeinfadwthgisktpmlkaq
hpdwelyktgihgqkgvscadchmpytqegavkysdhkvgnpldnmdkscmnchreseqk
lkdivkqkferkeflqdiafdnigkahletgkamelgatdaelkeirthirhaqwradma
iaghgsffhapeevlrllasgneeaqkariklvkvlakygaidyvapdfetkekaqklak
vdmeafiaeklkfkqtleqewkkqaiakgrlnpeslkgvdekssyydktkk

Timeline for d2e80a1:

• d2e80a1 is new in SCOP 1.73
  
• d2e80a1 appears in SCOP 1.75
  
• d2e80a1 appears in the current release, SCOPe 2.08, called d2e80a_