Lineage for d2e7td1 (2e7t D:1-237)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663637Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (9 PDB entries)
  8. 663655Domain d2e7td1: 2e7t D:1-237 [132091]
    automatically matched to d1wbfa_
    complexed with a2g, bma, ca, fuc, gal, glc, mn, nag

Details for d2e7td1

PDB Entry: 2e7t (more details), 2.65 Å

PDB Description: crystal structure of basic winged bean lectin in complex with a blood group trisaccharide
PDB Compounds: (D:) Basic agglutinin

SCOP Domain Sequences for d2e7td1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e7td1 b.29.1.1 (D:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

SCOP Domain Coordinates for d2e7td1:

Click to download the PDB-style file with coordinates for d2e7td1.
(The format of our PDB-style files is described here.)

Timeline for d2e7td1: