SCOPe 2.08: Domain d2e7tc_: 2e7t C:

Lineage for d2e7tc_ (2e7t C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries)

8. Domain d2e7tc_: 2e7t C: [132090]
   automated match to d1wbfa_
   complexed with ca, mn

Details for d2e7tc_

PDB Entry: 2e7t, 2.65 Å

PDB Description: crystal structure of basic winged bean lectin in complex with a blood group trisaccharide

PDB Compounds: (C:) Basic agglutinin

SCOPe Domain Sequences for d2e7tc_:

Sequence; same for both SEQRES and ATOM records:

>d2e7tc_ b.29.1.1 (C:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

Timeline for d2e7tc_:

• d2e7tc_ first appeared in SCOP 1.73, called d2e7tc1
  
• d2e7tc_ appears in SCOPe 2.07