Lineage for d2e7sn1 (2e7s N:31-141)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 752208Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 753223Superfamily h.1.33: Sec2 N-terminal region [144284] (1 family) (S)
    dimeric coiled coil
  5. 753224Family h.1.33.1: Sec2 N-terminal region [144285] (1 protein)
  6. 753225Protein Rab guanine nucleotide exchange factor Sec2 [144286] (1 species)
  7. 753226Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144287] (2 PDB entries)
  8. 753240Domain d2e7sn1: 2e7s N:31-141 [132081]
    automatically matched to 2E7S A:31-144

Details for d2e7sn1

PDB Entry: 2e7s (more details), 3 Å

PDB Description: crystal structure of the yeast sec2p gef domain
PDB Compounds: (N:) Rab guanine nucleotide exchange factor SEC2

SCOP Domain Sequences for d2e7sn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e7sn1 h.1.33.1 (N:31-141) Rab guanine nucleotide exchange factor Sec2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekd

SCOP Domain Coordinates for d2e7sn1:

Click to download the PDB-style file with coordinates for d2e7sn1.
(The format of our PDB-style files is described here.)

Timeline for d2e7sn1: