Lineage for d2e7sf1 (2e7s F:31-144)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 894740Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 895804Superfamily h.1.33: Sec2 N-terminal region [144284] (1 family) (S)
    dimeric coiled coil
  5. 895805Family h.1.33.1: Sec2 N-terminal region [144285] (1 protein)
  6. 895806Protein Rab guanine nucleotide exchange factor Sec2 [144286] (1 species)
  7. 895807Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144287] (3 PDB entries)
    Uniprot P17065 16-162! Uniprot P17065 31-144
  8. 895813Domain d2e7sf1: 2e7s F:31-144 [132073]
    automatically matched to 2E7S A:31-144

Details for d2e7sf1

PDB Entry: 2e7s (more details), 3 Å

PDB Description: crystal structure of the yeast sec2p gef domain
PDB Compounds: (F:) Rab guanine nucleotide exchange factor SEC2

SCOP Domain Sequences for d2e7sf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e7sf1 h.1.33.1 (F:31-144) Rab guanine nucleotide exchange factor Sec2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmll

SCOP Domain Coordinates for d2e7sf1:

Click to download the PDB-style file with coordinates for d2e7sf1.
(The format of our PDB-style files is described here.)

Timeline for d2e7sf1: