SCOP 1.73: Domain d2e7ea1: 2e7e A:11-222

Lineage for d2e7ea1 (2e7e A:11-222)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins)

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48617] (13 PDB entries)

8. Domain d2e7ea1: 2e7e A:11-222 [132063]
   automatically matched to d1dvga_
   complexed with cyn, hem

Details for d2e7ea1

PDB Entry: 2e7e, 1.85 Å

PDB Description: Bent-binding of cyanide to the heme iron in rat heme oxygenase-1

PDB Compounds: (A:) Heme oxygenase 1

SCOP Domain Sequences for d2e7ea1:

Sequence; same for both SEQRES and ATOM records:

>d2e7ea1 a.132.1.1 (A:11-222) Heme oxygenase-1 (HO-1) {Rat (Rattus norvegicus) [TaxId: 10116]}
qdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernkq
npvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpellv
ahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntle
mtpevkhrvteeaktafllnielfeelqallt

Timeline for d2e7ea1:

• d2e7ea1 is new in SCOP 1.73
  
• d2e7ea1 appears in SCOP 1.75
  
• d2e7ea1 appears in the current release, SCOPe 2.08, called d2e7ea_