Lineage for d2e76a1 (2e76 A:13-214)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059237Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 1059238Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 1059244Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 1059245Protein Cytochrome b6 subunit of the cytochrome b6f complex [103498] (2 species)
  7. 1059248Species Mastigocladus laminosus [TaxId:83541] [103499] (5 PDB entries)
  8. 1059250Domain d2e76a1: 2e76 A:13-214 [132058]
    Other proteins in same PDB: d2e76b1, d2e76d1, d2e76d2, d2e76e1, d2e76f1, d2e76g1, d2e76h1
    automatically matched to d1vf5a_
    complexed with bcr, cd, cla, fes, hem, opc, sqd, tds, umq

Details for d2e76a1

PDB Entry: 2e76 (more details), 3.41 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex with tridecyl-stigmatellin (TDS) from M.laminosus
PDB Compounds: (A:) Cytochrome b6

SCOPe Domain Sequences for d2e76a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e76a1 f.21.1.2 (A:13-214) Cytochrome b6 subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
eiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptvteayasvqyi
mnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgvilavitvsfg
vtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltryysahtfvlp
wliavfmllhflmirkqgisgp

SCOPe Domain Coordinates for d2e76a1:

Click to download the PDB-style file with coordinates for d2e76a1.
(The format of our PDB-style files is described here.)

Timeline for d2e76a1: