Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) |
Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins) |
Protein PetM subunit of the cytochrome b6f complex [103443] (2 species) |
Species Mastigocladus laminosus [TaxId:83541] [103444] (9 PDB entries) |
Domain d2e75f1: 2e75 F:1-32 [132056] Other proteins in same PDB: d2e75a1, d2e75b1, d2e75d1, d2e75d2, d2e75e1, d2e75g1, d2e75h1 automatically matched to d1vf5s_ complexed with bcr, cd, cla, fes, hem, opc, qno, sqd, umq |
PDB Entry: 2e75 (more details), 3.55 Å
SCOPe Domain Sequences for d2e75f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e75f1 f.23.25.1 (F:1-32) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]} mteemlyaallsfglifvgwglgvlllkiqga
Timeline for d2e75f1: