Lineage for d2e75f1 (2e75 F:1-32)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2579085Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) (S)
  5. 2579086Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins)
  6. 2579087Protein PetM subunit of the cytochrome b6f complex [103443] (2 species)
  7. 2579090Species Mastigocladus laminosus [TaxId:83541] [103444] (9 PDB entries)
  8. 2579100Domain d2e75f1: 2e75 F:1-32 [132056]
    Other proteins in same PDB: d2e75a1, d2e75b1, d2e75d1, d2e75d2, d2e75e1, d2e75g1, d2e75h1
    automatically matched to d1vf5s_
    complexed with bcr, cd, cla, fes, hem, opc, qno, sqd, umq

Details for d2e75f1

PDB Entry: 2e75 (more details), 3.55 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO) from M.laminosus
PDB Compounds: (F:) Cytochrome b6-f complex subunit 7

SCOPe Domain Sequences for d2e75f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e75f1 f.23.25.1 (F:1-32) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
mteemlyaallsfglifvgwglgvlllkiqga

SCOPe Domain Coordinates for d2e75f1:

Click to download the PDB-style file with coordinates for d2e75f1.
(The format of our PDB-style files is described here.)

Timeline for d2e75f1: