Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) |
Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins) |
Protein ISP subunit from the cytochrome b6f complex, transmembrane anchor [103428] (2 species) |
Domain d2e75d2: 2e75 D:12-45 [132055] Other proteins in same PDB: d2e75a1, d2e75b1, d2e75d1, d2e75e1, d2e75f1, d2e75g1, d2e75h1 automatically matched to d1vf5d2 complexed with bcr, cd, cla, fes, hem, opc, qno, sqd, umq |
PDB Entry: 2e75 (more details), 3.55 Å
SCOPe Domain Sequences for d2e75d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e75d2 f.23.12.1 (D:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]} dmgrrqfmnllafgtvtgvalgalyplvkyfipp
Timeline for d2e75d2: