Lineage for d2e75d2 (2e75 D:12-45)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025862Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 3025863Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 3025907Protein ISP subunit from the cytochrome b6f complex, transmembrane anchor [103428] (2 species)
  7. Species Mastigocladus laminosus [TaxId:83541] [103429] (4 PDB entries)
  8. 3025914Domain d2e75d2: 2e75 D:12-45 [132055]
    Other proteins in same PDB: d2e75a1, d2e75b1, d2e75d1, d2e75e1, d2e75f1, d2e75g1, d2e75h1
    automatically matched to d1vf5d2
    complexed with bcr, cd, cla, fes, hem, opc, qno, sqd, umq

Details for d2e75d2

PDB Entry: 2e75 (more details), 3.55 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO) from M.laminosus
PDB Compounds: (D:) Cytochrome b6-f complex iron-sulfur subunit

SCOPe Domain Sequences for d2e75d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e75d2 f.23.12.1 (D:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]}
dmgrrqfmnllafgtvtgvalgalyplvkyfipp

SCOPe Domain Coordinates for d2e75d2:

Click to download the PDB-style file with coordinates for d2e75d2.
(The format of our PDB-style files is described here.)

Timeline for d2e75d2: