![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
![]() | Protein ISP subunit from the cytochrome b6f complex, soluble domain [101665] (2 species) |
![]() | Domain d2e75d1: 2e75 D:46-179 [132054] Other proteins in same PDB: d2e75a1, d2e75b1, d2e75d2, d2e75e1, d2e75f1, d2e75g1, d2e75h1 automatically matched to d1vf5d1 complexed with bcr, cd, cla, fes, hem, opc, qno, sqd, umq |
PDB Entry: 2e75 (more details), 3.55 Å
SCOPe Domain Sequences for d2e75d1:
Sequence, based on SEQRES records: (download)
>d2e75d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]} sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdygin avcthlgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpw tetdfrtgekpwwv
>d2e75d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]} sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivairdyginavcth lgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpwtetdf rtgekpwwv
Timeline for d2e75d1: