Lineage for d2e74g_ (2e74 G:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631663Superfamily f.23.26: PetG subunit of the cytochrome b6f complex [103446] (1 family) (S)
  5. 2631664Family f.23.26.1: PetG subunit of the cytochrome b6f complex [103447] (2 proteins)
  6. 2631675Protein automated matches [196847] (1 species)
    not a true protein
  7. 2631676Species Mastigocladus laminosus [TaxId:83541] [196848] (5 PDB entries)
  8. 2631677Domain d2e74g_: 2e74 G: [132052]
    Other proteins in same PDB: d2e74a_, d2e74b1, d2e74d1, d2e74d2, d2e74e1, d2e74f_, d2e74h_
    automated match to d4i7zg_
    complexed with bcr, cd, cla, fes, hem, opc, sqd, umq

Details for d2e74g_

PDB Entry: 2e74 (more details), 3 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from M.laminosus
PDB Compounds: (G:) Cytochrome b6-f complex subunit 5

SCOPe Domain Sequences for d2e74g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e74g_ f.23.26.1 (G:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
mveplldglvlglvfatlgglfyaayqqykrpnelgg

SCOPe Domain Coordinates for d2e74g_:

Click to download the PDB-style file with coordinates for d2e74g_.
(The format of our PDB-style files is described here.)

Timeline for d2e74g_: