SCOPe 2.07: Domain d2e74g_: 2e74 G:

Lineage for d2e74g_ (2e74 G:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.26: PetG subunit of the cytochrome b6f complex [103446] (1 family)

5. Family f.23.26.1: PetG subunit of the cytochrome b6f complex [103447] (2 proteins)

6. Protein automated matches [196847] (1 species)
   not a true protein

7. Species Mastigocladus laminosus [TaxId:83541] [196848] (5 PDB entries)

8. Domain d2e74g_: 2e74 G: [132052]
   Other proteins in same PDB: d2e74a_, d2e74b1, d2e74d1, d2e74d2, d2e74e1, d2e74f_, d2e74h_
   automated match to d4i7zg_
   complexed with bcr, cd, cla, fes, hem, opc, sqd, umq

Details for d2e74g_

PDB Entry: 2e74, 3 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from M.laminosus

PDB Compounds: (G:) Cytochrome b6-f complex subunit 5

SCOPe Domain Sequences for d2e74g_:

Sequence; same for both SEQRES and ATOM records:

>d2e74g_ f.23.26.1 (G:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
mveplldglvlglvfatlgglfyaayqqykrpnelgg

Timeline for d2e74g_:

• d2e74g_ first appeared in SCOP 1.73, called d2e74g1
  
• d2e74g_ appears in SCOPe 2.06
  
• d2e74g_ appears in the current release, SCOPe 2.08