![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
![]() | Protein automated matches [190874] (7 species) not a true protein |
![]() | Species Mastigocladus laminosus [TaxId:83541] [255132] (4 PDB entries) |
![]() | Domain d2e74d1: 2e74 D:46-179 [132049] Other proteins in same PDB: d2e74a_, d2e74b1, d2e74d2, d2e74e1, d2e74f_, d2e74g_, d2e74h_ automated match to d1vf5d1 complexed with bcr, cd, cla, fes, hem, opc, sqd, umq |
PDB Entry: 2e74 (more details), 3 Å
SCOPe Domain Sequences for d2e74d1:
Sequence, based on SEQRES records: (download)
>d2e74d1 b.33.1.1 (D:46-179) automated matches {Mastigocladus laminosus [TaxId: 83541]} sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdygin avcthlgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpw tetdfrtgekpwwv
>d2e74d1 b.33.1.1 (D:46-179) automated matches {Mastigocladus laminosus [TaxId: 83541]} sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivairdyginavcth lgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpwtetdf rtgekpwwv
Timeline for d2e74d1: