![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (3 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins) |
![]() | Protein ISP subunit from the cytochrome b6f complex, soluble domain [101665] (2 species) |
![]() | Species Mastigocladus laminosus [TaxId:83541] [101666] (5 PDB entries) |
![]() | Domain d2e74d1: 2e74 D:46-179 [132049] Other proteins in same PDB: d2e74a1, d2e74b1, d2e74d2, d2e74e1, d2e74f1, d2e74g1, d2e74h1 automatically matched to d1vf5d1 complexed with bcr, cd, cla, fes, hem, opc, sqd, umq |
PDB Entry: 2e74 (more details), 3 Å
SCOP Domain Sequences for d2e74d1:
Sequence, based on SEQRES records: (download)
>d2e74d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]} sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdygin avcthlgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpw tetdfrtgekpwwv
>d2e74d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]} sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivairdyginavcth lgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpwtetdf rtgekpwwv
Timeline for d2e74d1: