Lineage for d2e74a_ (2e74 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629948Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2629949Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 2629955Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 2630012Protein automated matches [196844] (6 species)
    not a true protein
  7. 2630030Species Mastigocladus laminosus [TaxId:83541] [196845] (5 PDB entries)
  8. 2630031Domain d2e74a_: 2e74 A: [132048]
    Other proteins in same PDB: d2e74b1, d2e74d1, d2e74d2, d2e74e1, d2e74f_, d2e74g_, d2e74h_
    automated match to d4i7za_
    complexed with bcr, cd, cla, fes, hem, opc, sqd, umq

Details for d2e74a_

PDB Entry: 2e74 (more details), 3 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from M.laminosus
PDB Compounds: (A:) Cytochrome b6

SCOPe Domain Sequences for d2e74a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e74a_ f.21.1.2 (A:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
manvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykp
tvteayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwis
gvilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatl
tryysahtfvlpwliavfmllhflmirkqgisgpl

SCOPe Domain Coordinates for d2e74a_:

Click to download the PDB-style file with coordinates for d2e74a_.
(The format of our PDB-style files is described here.)

Timeline for d2e74a_: