Lineage for d2e74a1 (2e74 A:13-214)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887002Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 887003Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 887009Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 887010Protein Cytochrome b6 subunit of the cytochrome b6f complex [103498] (2 species)
  7. 887013Species Mastigocladus laminosus [TaxId:83541] [103499] (5 PDB entries)
  8. 887014Domain d2e74a1: 2e74 A:13-214 [132048]
    Other proteins in same PDB: d2e74b1, d2e74d1, d2e74d2, d2e74e1, d2e74f1, d2e74g1, d2e74h1
    automatically matched to d1vf5a_
    complexed with bcr, cd, cla, fes, hem, opc, sqd, umq

Details for d2e74a1

PDB Entry: 2e74 (more details), 3 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from M.laminosus
PDB Compounds: (A:) Cytochrome b6

SCOP Domain Sequences for d2e74a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e74a1 f.21.1.2 (A:13-214) Cytochrome b6 subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
eiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptvteayasvqyi
mnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgvilavitvsfg
vtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltryysahtfvlp
wliavfmllhflmirkqgisgp

SCOP Domain Coordinates for d2e74a1:

Click to download the PDB-style file with coordinates for d2e74a1.
(The format of our PDB-style files is described here.)

Timeline for d2e74a1: