SCOP 1.73: Domain d2e6yb1: 2e6y B:1011-1222

Lineage for d2e6yb1 (2e6y B:1011-1222)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families)

5. Family c.1.2.3: Decarboxylase [51375] (3 proteins)

6. Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)

7. Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (18 PDB entries)

8. Domain d2e6yb1: 2e6y B:1011-1222 [132047]
   automatically matched to d1klya_
   complexed with gol, u5p; mutant

Details for d2e6yb1

PDB Entry: 2e6y, 1.6 Å

PDB Description: covalent complex of orotidine 5'-monophosphate decarboxylase (odcase) with 6-iodo-ump

PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOP Domain Sequences for d2e6yb1:

Sequence; same for both SEQRES and ATOM records:

>d2e6yb1 c.1.2.3 (B:1011-1222) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiiesi

Timeline for d2e6yb1:

• d2e6yb1 is new in SCOP 1.73
  
• d2e6yb1 appears in SCOP 1.75
  
• d2e6yb1 appears in the current release, SCOPe 2.08, called d2e6yb_