| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) ![]() |
| Family c.1.2.3: Decarboxylase [51375] (3 proteins) |
| Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species) |
| Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (18 PDB entries) |
| Domain d2e6ya1: 2e6y A:11-222 [132046] automatically matched to d1klya_ complexed with gol, u5p; mutant |
PDB Entry: 2e6y (more details), 1.6 Å
SCOP Domain Sequences for d2e6ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e6ya1 c.1.2.3 (A:11-222) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiiesi
Timeline for d2e6ya1: