![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) ![]() |
![]() | Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
![]() | Protein Ribosomal protein S18 [46913] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries) Uniprot P80382 |
![]() | Domain d2e5lr1: 2e5l R:16-88 [132042] Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5ls1, d2e5lt1, d2e5lv1 automatically matched to d1i94r_ complexed with zn |
PDB Entry: 2e5l (more details), 3.3 Å
SCOPe Domain Sequences for d2e5lr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e5lr1 a.4.8.1 (R:16-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]} psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari lgllpfteklvrk
Timeline for d2e5lr1: