Lineage for d2e5lp1 (2e5l P:1-83)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023011Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 1023012Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 1023013Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 1023014Protein Ribosomal protein S16 [54567] (3 species)
  7. 1023044Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
    Uniprot P80379
  8. 1023063Domain d2e5lp1: 2e5l P:1-83 [132040]
    Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1, d2e5lv1
    automatically matched to d1emwa_
    complexed with zn

Details for d2e5lp1

PDB Entry: 2e5l (more details), 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d2e5lp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e5lp1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOPe Domain Coordinates for d2e5lp1:

Click to download the PDB-style file with coordinates for d2e5lp1.
(The format of our PDB-style files is described here.)

Timeline for d2e5lp1: