![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
![]() | Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) ![]() |
![]() | Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
![]() | Protein Ribosomal protein S16 [54567] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries) Uniprot P80379 |
![]() | Domain d2e5lp1: 2e5l P:1-83 [132040] Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1, d2e5lv1 automatically matched to d1emwa_ complexed with zn |
PDB Entry: 2e5l (more details), 3.3 Å
SCOP Domain Sequences for d2e5lp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e5lp1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqe
Timeline for d2e5lp1: