SCOP 1.73: Domain d2e5lp1: 2e5l P:1-83

Lineage for d2e5lp1 (2e5l P:1-83)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
   beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234

4. Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family)

5. Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)

6. Protein Ribosomal protein S16 [54567] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)

8. Domain d2e5lp1: 2e5l P:1-83 [132040]
   Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1
   automatically matched to d1emwa_
   complexed with zn

Details for d2e5lp1

PDB Entry: 2e5l, 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction

PDB Compounds: (P:) 30S ribosomal protein S16

SCOP Domain Sequences for d2e5lp1:

Sequence; same for both SEQRES and ATOM records:

>d2e5lp1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

Timeline for d2e5lp1:

• d2e5lp1 is new in SCOP 1.73
  
• d2e5lp1 appears in SCOP 1.75
  
• d2e5lp1 appears in the current release, SCOPe 2.08