Lineage for d2e5lk1 (2e5l K:11-125)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 702503Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 702504Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 702551Protein Ribosomal protein S11 [53141] (1 species)
  7. 702552Species Thermus thermophilus [TaxId:274] [53142] (37 PDB entries)
  8. 702575Domain d2e5lk1: 2e5l K:11-125 [132035]
    Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1
    automatically matched to d1i94k_
    complexed with zn

Details for d2e5lk1

PDB Entry: 2e5l (more details), 3.3 Å

PDB Description: A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine- Dalgarno interaction
PDB Compounds: (K:) 30S ribosomal protein S11

SCOP Domain Sequences for d2e5lk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e5lk1 c.55.4.1 (K:11-125) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkf

SCOP Domain Coordinates for d2e5lk1:

Click to download the PDB-style file with coordinates for d2e5lk1.
(The format of our PDB-style files is described here.)

Timeline for d2e5lk1: