Lineage for d2e5lj1 (2e5l J:3-100)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725134Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 725135Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 725136Protein Ribosomal protein S10 [55001] (1 species)
  7. 725137Species Thermus thermophilus [TaxId:274] [55002] (36 PDB entries)
  8. 725160Domain d2e5lj1: 2e5l J:3-100 [132034]
    Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1
    automatically matched to d1fjgj_
    complexed with zn

Details for d2e5lj1

PDB Entry: 2e5l (more details), 3.3 Å

PDB Description: A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine- Dalgarno interaction
PDB Compounds: (J:) 30S ribosomal protein S10

SCOP Domain Sequences for d2e5lj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e5lj1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOP Domain Coordinates for d2e5lj1:

Click to download the PDB-style file with coordinates for d2e5lj1.
(The format of our PDB-style files is described here.)

Timeline for d2e5lj1: