Lineage for d2e5lh1 (2e5l H:1-138)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734191Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 734192Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 734193Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 734194Protein Ribosomal protein S8 [56049] (4 species)
  7. 734212Species Thermus thermophilus [TaxId:274] [56051] (37 PDB entries)
  8. 734237Domain d2e5lh1: 2e5l H:1-138 [132032]
    Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1
    automatically matched to d1fjgh_
    complexed with zn

Details for d2e5lh1

PDB Entry: 2e5l (more details), 3.3 Å

PDB Description: A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine- Dalgarno interaction
PDB Compounds: (H:) 30S ribosomal protein S8

SCOP Domain Sequences for d2e5lh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e5lh1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOP Domain Coordinates for d2e5lh1:

Click to download the PDB-style file with coordinates for d2e5lh1.
(The format of our PDB-style files is described here.)

Timeline for d2e5lh1: