Lineage for d2e5lg1 (2e5l G:2-156)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772539Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 772540Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 772541Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 772542Protein Ribosomal protein S7 [47975] (4 species)
  7. 772572Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 772594Domain d2e5lg1: 2e5l G:2-156 [132031]
    Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1, d2e5lv1
    automatically matched to d1fjgg_
    complexed with zn

Details for d2e5lg1

PDB Entry: 2e5l (more details), 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
PDB Compounds: (G:) 30S ribosomal protein S7

SCOP Domain Sequences for d2e5lg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e5lg1 a.75.1.1 (G:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOP Domain Coordinates for d2e5lg1:

Click to download the PDB-style file with coordinates for d2e5lg1.
(The format of our PDB-style files is described here.)

Timeline for d2e5lg1: