Lineage for d2e5lf1 (2e5l F:1-101)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909830Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1909831Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1909832Protein Ribosomal protein S6 [54997] (4 species)
  7. 1909862Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 1909888Domain d2e5lf1: 2e5l F:1-101 [132030]
    Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1, d2e5lv1
    automatically matched to d1fjgf_
    complexed with zn

Details for d2e5lf1

PDB Entry: 2e5l (more details), 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2e5lf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e5lf1 d.58.14.1 (F:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d2e5lf1:

Click to download the PDB-style file with coordinates for d2e5lf1.
(The format of our PDB-style files is described here.)

Timeline for d2e5lf1: