| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) ![]() |
| Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein) |
| Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species) lacks the N-terminal helix |
| Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries) Uniprot P27152 |
| Domain d2e5le2: 2e5l E:5-73 [132029] Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1, d2e5lv1 automatically matched to d1i94e2 complexed with zn |
PDB Entry: 2e5l (more details), 3.3 Å
SCOP Domain Sequences for d2e5le2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e5le2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn
Timeline for d2e5le2: