SCOPe 2.01: Domain d2e33b_: 2e33 B:

Lineage for d2e33b_ (2e33 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186780] (69 PDB entries)

8. Domain d2e33b_: 2e33 B: [132021]
   Other proteins in same PDB: d2e33a_
   automated match to d1a2wa_

Details for d2e33b_

PDB Entry: 2e33, 2.7 Å

PDB Description: structural basis for selection of glycosylated substrate by scffbs1 ubiquitin ligase

PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d2e33b_:

Sequence; same for both SEQRES and ATOM records:

>d2e33b_ d.5.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d2e33b_:

• d2e33b_ first appeared in SCOP 1.73, called d2e33b1
  
• d2e33b_ was called d2e33b1 in SCOP 1.75
  
• d2e33b_ appears in SCOPe 2.02
  
• d2e33b_ appears in the current release, SCOPe 2.08