Lineage for d2e33a_ (2e33 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2046988Family b.18.1.21: F-box associated region, FBA [101585] (2 proteins)
    automatically mapped to Pfam PF04300
  6. 2046993Protein automated matches [190275] (1 species)
    not a true protein
  7. 2046994Species Mouse (Mus musculus) [TaxId:10090] [187067] (3 PDB entries)
  8. 2046998Domain d2e33a_: 2e33 A: [132020]
    Other proteins in same PDB: d2e33b_
    automated match to d1umha_

Details for d2e33a_

PDB Entry: 2e33 (more details), 2.7 Å

PDB Description: structural basis for selection of glycosylated substrate by scffbs1 ubiquitin ligase
PDB Compounds: (A:) F-box only protein 2

SCOPe Domain Sequences for d2e33a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e33a_ b.18.1.21 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rrrnllrnpcgeedlegwsdvehggdgwkveelpgdngveftqddsvkkyfassfewcrk
aqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsenedvlaefatgq
vavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnssvwvep

SCOPe Domain Coordinates for d2e33a_:

Click to download the PDB-style file with coordinates for d2e33a_.
(The format of our PDB-style files is described here.)

Timeline for d2e33a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2e33b_