SCOP 1.75: Domain d2e33a1: 2e33 A:123-297

Lineage for d2e33a1 (2e33 A:123-297)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families)

5. Family b.18.1.21: F-box associated region, FBA [101585] (1 protein)

6. Protein F-box only protein 2 [101586] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101587] (3 PDB entries)

8. Domain d2e33a1: 2e33 A:123-297 [132020]
   Other proteins in same PDB: d2e33b1
   automatically matched to d1umha_
   complexed with bma, man, nag

Details for d2e33a1

PDB Entry: 2e33, 2.7 Å

PDB Description: structural basis for selection of glycosylated substrate by scffbs1 ubiquitin ligase

PDB Compounds: (A:) F-box only protein 2

SCOP Domain Sequences for d2e33a1:

Sequence; same for both SEQRES and ATOM records:

>d2e33a1 b.18.1.21 (A:123-297) F-box only protein 2 {Mouse (Mus musculus) [TaxId: 10090]}
rrrnllrnpcgeedlegwsdvehggdgwkveelpgdngveftqddsvkkyfassfewcrk
aqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsenedvlaefatgq
vavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnssvwvep

Timeline for d2e33a1:

• d2e33a1 first appeared in SCOP 1.73
  
• d2e33a1 is called d2e33a_ in SCOPe 2.01
  
• d2e33a1 appears in the current release, SCOPe 2.08, called d2e33a_