Lineage for d2e33a1 (2e33 A:123-297)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662025Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 662026Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families) (S)
  5. 662430Family b.18.1.21: F-box associated region, FBA [101585] (1 protein)
  6. 662431Protein F-box only protein 2 [101586] (1 species)
  7. 662432Species Mouse (Mus musculus) [TaxId:10090] [101587] (3 PDB entries)
  8. 662435Domain d2e33a1: 2e33 A:123-297 [132020]
    Other proteins in same PDB: d2e33b1
    automatically matched to d1umha_
    complexed with bma, man, nag

Details for d2e33a1

PDB Entry: 2e33 (more details), 2.7 Å

PDB Description: Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
PDB Compounds: (A:) F-box only protein 2

SCOP Domain Sequences for d2e33a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e33a1 b.18.1.21 (A:123-297) F-box only protein 2 {Mouse (Mus musculus) [TaxId: 10090]}
rrrnllrnpcgeedlegwsdvehggdgwkveelpgdngveftqddsvkkyfassfewcrk
aqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsenedvlaefatgq
vavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnssvwvep

SCOP Domain Coordinates for d2e33a1:

Click to download the PDB-style file with coordinates for d2e33a1.
(The format of our PDB-style files is described here.)

Timeline for d2e33a1: