SCOPe 2.08: Domain d2e33a_: 2e33 A:

Lineage for d2e33a_ (2e33 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.21: F-box associated region, FBA [101585] (2 proteins)
   automatically mapped to Pfam PF04300

6. Protein automated matches [190275] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187067] (3 PDB entries)

8. Domain d2e33a_: 2e33 A: [132020]
   Other proteins in same PDB: d2e33b_
   automated match to d1umha_

Details for d2e33a_

PDB Entry: 2e33, 2.7 Å

PDB Description: structural basis for selection of glycosylated substrate by scffbs1 ubiquitin ligase

PDB Compounds: (A:) F-box only protein 2

SCOPe Domain Sequences for d2e33a_:

Sequence; same for both SEQRES and ATOM records:

>d2e33a_ b.18.1.21 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rrrnllrnpcgeedlegwsdvehggdgwkveelpgdngveftqddsvkkyfassfewcrk
aqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsenedvlaefatgq
vavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnssvwvep

Timeline for d2e33a_:

• d2e33a_ first appeared in SCOP 1.73, called d2e33a1
  
• d2e33a_ appears in SCOPe 2.07