Class g: Small proteins [56992] (90 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) |
Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins) |
Protein RBP9 subunit of RNA polymerase II [57787] (3 species) contains two differently decorated domains of this fold |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries) Uniprot P27999; part of multichain biological unit |
Domain d2e2ji2: 2e2j I:50-120 [132016] Other proteins in same PDB: d2e2ja1, d2e2jb1, d2e2jc1, d2e2jc2, d2e2je1, d2e2je2, d2e2jf1, d2e2jh1, d2e2jj1, d2e2jk1, d2e2jl1 automatically matched to d1i3qi2 protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn |
PDB Entry: 2e2j (more details), 3.5 Å
SCOPe Domain Sequences for d2e2ji2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e2ji2 g.41.3.1 (I:50-120) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi ftsdqknkrtq
Timeline for d2e2ji2: