SCOPe 2.08: Domain d2e2jc2: 2e2j C:42-172

Lineage for d2e2jc2 (2e2j C:42-172)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)
   automatically mapped to Pfam PF01000

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)

6. Protein RPB3 [64462] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)
   Uniprot P16370; part of multichain biological unit

8. Domain d2e2jc2: 2e2j C:42-172 [132010]
   Other proteins in same PDB: d2e2ja1, d2e2jb1, d2e2jc1, d2e2je1, d2e2je2, d2e2jf1, d2e2jh1, d2e2ji1, d2e2ji2, d2e2jj1, d2e2jk1, d2e2jl1
   automatically matched to d1i3qc2
   protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn

Details for d2e2jc2

PDB Entry: 2e2j, 3.5 Å

PDB Description: rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp

PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d2e2jc2:

Sequence; same for both SEQRES and ATOM records:

>d2e2jc2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

Timeline for d2e2jc2:

• d2e2jc2 first appeared in SCOP 1.73
  
• d2e2jc2 appears in SCOPe 2.07