Lineage for d2e2jc1 (2e2j C:3-37,C:173-268)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564740Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2564876Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2564877Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)
  6. 2564957Protein RPB3 [64315] (2 species)
  7. 2564958Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 2564972Domain d2e2jc1: 2e2j C:3-37,C:173-268 [132009]
    Other proteins in same PDB: d2e2ja1, d2e2jb1, d2e2jc2, d2e2je1, d2e2je2, d2e2jf1, d2e2jh1, d2e2ji1, d2e2ji2, d2e2jj1, d2e2jk1, d2e2jl1
    automatically matched to d1i3qc1
    protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn

Details for d2e2jc1

PDB Entry: 2e2j (more details), 3.5 Å

PDB Description: rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d2e2jc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2jc1 d.74.3.1 (C:3-37,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmXaaaiefeydpwnklkhtdywyeqd
sakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlqkkva
sillaltqmdqd

SCOPe Domain Coordinates for d2e2jc1:

Click to download the PDB-style file with coordinates for d2e2jc1.
(The format of our PDB-style files is described here.)

Timeline for d2e2jc1: