Lineage for d2e2jb1 (2e2j B:20-1222)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 744107Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 744108Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 744109Family e.29.1.1: RNA-polymerase beta [64485] (2 proteins)
  6. 744110Protein RBP2 [64491] (1 species)
  7. 744111Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64492] (24 PDB entries)
  8. 744124Domain d2e2jb1: 2e2j B:20-1222 [132008]
    Other proteins in same PDB: d2e2ja1, d2e2jc1, d2e2jc2, d2e2je1, d2e2je2, d2e2jf1, d2e2jh1, d2e2ji1, d2e2ji2, d2e2jj1, d2e2jk1, d2e2jl1
    automatically matched to d1i50b_
    complexed with g2p, mg, zn

Details for d2e2jb1

PDB Entry: 2e2j (more details), 3.5 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with GMPCPP
PDB Compounds: (B:) DNA-directed RNA polymerase II 140 kDa polypeptide

SCOP Domain Sequences for d2e2jb1:

Sequence, based on SEQRES records: (download)

>d2e2jb1 e.29.1.1 (B:20-1222) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlileqlaqhtt
esdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyea
idvpgrelkyeliaeeseddsesgkvfigrlpimlrskncylseatesdlyklkecpfdm
ggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgsrfistlqvkly
gregssartikatlpyikqdipiviifralgiipdgeilehicydvndwqmlemlkpcve
dgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqlegfesrkafflg
yminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtveea
hdfnmklainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrrtn
tpigrdgklakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitfls
ewgmepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdi
rekelkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdieggfedveey
twssllneglveyidaeeeesiliamqpedlepaeaneendldvdpakrirvshhattft
hceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyyp
qkplgttrameylkfrelpagqnaivaiacysgynqedsmimnqssidrglfrslffrsy
mdqekkygmsitetfekpqrtntlrmkhgtydkldddgliapgvrvsgedviigkttpis
pdeeelgqrtayhskrdastplrstengivdqvlvttnqdglkfvkvrvrttkipqigdk
fasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecllskvaalsg
negdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgptyyqrlrhmv
ddkiharargpmqvltrqpvegrsrdgglrfgemerdcmiahgaasflkerlmeasdafr
vhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprlytd
rsr

Sequence, based on observed residues (ATOM records): (download)

>d2e2jb1 e.29.1.1 (B:20-1222) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlieisfgkiyv
tkpmvnesdgvthalypqearlrnltyssglfvdvkkkvfigrlpimlrskncylseate
sdlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalek
gsrfistlqvklygregssartikatlpyikqdipiviifralgiipdgeilehicydvn
dwqmlemlkpcvedgfviqdretaldfigkekriqyakdilqkeflphitqlegfesrka
fflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrt
velainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrrtntpia
kprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewgmepledy
vphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdirekelkiftd
agrvyrplfiveddeslghkelkvrkghiaklmateyqdeytwssllneglveyidaeee
esiliamqpedlepaeadvdpakrirvshhattfthceihpsmilgvaasiipfpdhnqs
prntyqsamgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrelpagqnai
vaiacysgynqedsmimnqssidrglfrslffrsymdqekkygmsitetfekpqrtntlr
mkhgtydkldddgliapgvrvsgedviigkttpisskrdastplrstengivdqvlvttn
qdglkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdliinphai
psrmtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfevmynght
gkklmaqiffgptyyqrlrhmvddkiharargpmqvltrqpvegrsrdgglrfgemerdc
miahgaasflkerlmeasdafrvhicgicglmtviaklnhnqfeckgcdnkidiyqihip
yaakllfqelmamnitprlytdrsr

SCOP Domain Coordinates for d2e2jb1:

Click to download the PDB-style file with coordinates for d2e2jb1.
(The format of our PDB-style files is described here.)

Timeline for d2e2jb1: