Lineage for d2e2ja1 (2e2j A:3-1445)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249905Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2249906Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2249995Family e.29.1.2: RNA-polymerase beta-prime [64490] (3 proteins)
  6. 2249996Protein RBP1 [64486] (2 species)
  7. 2249997Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64487] (24 PDB entries)
    Uniprot P04050; part of multichain biological unit
  8. 2250011Domain d2e2ja1: 2e2j A:3-1445 [132007]
    Other proteins in same PDB: d2e2jb1, d2e2jc1, d2e2jc2, d2e2je1, d2e2je2, d2e2jf1, d2e2jh1, d2e2ji1, d2e2ji2, d2e2jj1, d2e2jk1, d2e2jl1
    automatically matched to d1i50a_
    protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn

Details for d2e2ja1

PDB Entry: 2e2j (more details), 3.5 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with GMPCPP
PDB Compounds: (A:) DNA-directed RNA polymerase II largest subunit

SCOPe Domain Sequences for d2e2ja1:

Sequence, based on SEQRES records: (download)

>d2e2ja1 e.29.1.2 (A:3-1445) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsid
rnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnelm
rqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglklv
gswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvp
pppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhvat
ymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnleld
qvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskrag
diqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynadf
dgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfie
ldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspkd
ngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhngf
stgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrfl
neardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdr
tlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrlv
kaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdll
ntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnirr
iiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccll
rsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtln
tfhfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaiehtt
lksvtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldraam
ndkdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhmlkk
ientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpgi
dptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqgglt
svtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtgafd
vmi

Sequence, based on observed residues (ATOM records): (download)

>d2e2ja1 e.29.1.2 (A:3-1445) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsid
rnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnelm
rqalaikdskkrfaaiwtlcktkmvcetdvpslvsrggcgntqptirkdglklvgswklr
vlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvppppvrpsisfnesqrged
dltfkladilkanisletlehngaphhaieeaesllqfhvatymdndiagqpqalqksgr
pvksirarlkgkegrirgnlmgkrvdfsartvisgdpnleldqvgvpksiaktltypevv
tpynidrltqlvrngpnehpgakyvirdsgdridlryskragdiqlqygwkverhimdnd
pvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynadfdgdemnlhvpqseetrae
lsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfieldqvlnmlywvpdwdgvi
ptpaiikpkplwsgkqilsvaipngihlqrfdegttllspkdngmliidgqiifgvvekk
tvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhngfstgigdtiadgptmreit
etiaeakkkvldvtkeaqanlltakhgmtlresfednvvrflneardkagrlaevnlkdl
nnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdrtlphfskddyspeskgfv
ensylrgltpqefffhamggreglidtavktaetgyiqrrlvkaledimvhydnttrnsl
gnviqfiygedgmdaahiekqsldtiggsdaafekryrvdllntdhtldpsllesgseil
gdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnirriiqnaqqtfhidhtkpsd
ltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccllrsrlatrrvlqeyrltkq
afdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtlkkvtsgvprlkeilnvakn
mktpsltvylepghaadqeqaklirsaiehttlksvtiaseiyydpdprstvipedeeii
qlhfslqqspwllrleldraamndkdltmgqvgerikqtfkndlfviwsedndekliirc
rvvaeedhmlkkientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdg
vnlsevmtvpgidptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmal
lvdvmttqggltsvtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvil
gqmapigtgafdvmi

SCOPe Domain Coordinates for d2e2ja1:

Click to download the PDB-style file with coordinates for d2e2ja1.
(The format of our PDB-style files is described here.)

Timeline for d2e2ja1: