Lineage for d2e2ik1 (2e2i K:1-114)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564740Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2564876Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2564986Family d.74.3.2: RBP11/RpoL [64311] (4 proteins)
  6. 2564996Protein RPB11 [64312] (2 species)
  7. 2564997Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (23 PDB entries)
    Uniprot P38902; part of multichain biological unit
  8. 2565008Domain d2e2ik1: 2e2i K:1-114 [132005]
    Other proteins in same PDB: d2e2ia1, d2e2ib1, d2e2ic1, d2e2ic2, d2e2ie1, d2e2ie2, d2e2if1, d2e2ih1, d2e2ii1, d2e2ii2, d2e2ij1, d2e2il1
    automatically matched to d1i3qk_
    protein/DNA complex; protein/RNA complex; complexed with dgt, mg, zn

Details for d2e2ik1

PDB Entry: 2e2i (more details), 3.41 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dGTP
PDB Compounds: (K:) DNA-directed RNA polymerase II 13.6 kDa polypeptide

SCOPe Domain Sequences for d2e2ik1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2ik1 d.74.3.2 (K:1-114) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d2e2ik1:

Click to download the PDB-style file with coordinates for d2e2ik1.
(The format of our PDB-style files is described here.)

Timeline for d2e2ik1: