Lineage for d2e2ij1 (2e2i J:1-65)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 636147Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
  5. 636148Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein)
    Zn-binding site is near the N-terminus
  6. 636149Protein RNA polymerase subunit RPB10 [46926] (2 species)
  7. 636152Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (24 PDB entries)
  8. 636164Domain d2e2ij1: 2e2i J:1-65 [132004]
    Other proteins in same PDB: d2e2ia1, d2e2ib1, d2e2ic1, d2e2ic2, d2e2ie1, d2e2ie2, d2e2if1, d2e2ih1, d2e2ii1, d2e2ii2, d2e2ik1, d2e2il1
    automatically matched to d1i3qj_
    complexed with dgt, mg, zn

Details for d2e2ij1

PDB Entry: 2e2i (more details), 3.41 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dGTP
PDB Compounds: (J:) DNA-directed RNA polymerases I/II/III subunit 10

SCOP Domain Sequences for d2e2ij1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2ij1 a.4.11.1 (J:1-65) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOP Domain Coordinates for d2e2ij1:

Click to download the PDB-style file with coordinates for d2e2ij1.
(The format of our PDB-style files is described here.)

Timeline for d2e2ij1: