![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein) duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10 automatically mapped to Pfam PF03870 |
![]() | Protein RNA polymerase subunit RBP8 [50322] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (36 PDB entries) Uniprot P20436 |
![]() | Domain d2e2ih1: 2e2i H:2-146 [132001] Other proteins in same PDB: d2e2ia1, d2e2ib1, d2e2ic1, d2e2ic2, d2e2ie1, d2e2ie2, d2e2if1, d2e2ii1, d2e2ii2, d2e2ij1, d2e2ik1, d2e2il1 automatically matched to d1a1d__ protein/DNA complex; protein/RNA complex; complexed with dgt, mg, zn |
PDB Entry: 2e2i (more details), 3.41 Å
SCOPe Domain Sequences for d2e2ih1:
Sequence, based on SEQRES records: (download)
>d2e2ih1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl lmrlegnyrnlnnlkqenayllirr
>d2e2ih1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln nlkqenayllirr
Timeline for d2e2ih1: