Lineage for d2e2ic2 (2e2i C:42-172)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2237535Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 2237536Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 2237537Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 2237610Protein RPB3 [64462] (2 species)
  7. 2237611Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 2237623Domain d2e2ic2: 2e2i C:42-172 [131997]
    Other proteins in same PDB: d2e2ia1, d2e2ib1, d2e2ic1, d2e2ie1, d2e2ie2, d2e2if1, d2e2ih1, d2e2ii1, d2e2ii2, d2e2ij1, d2e2ik1, d2e2il1
    automatically matched to d1i3qc2
    protein/DNA complex; protein/RNA complex; complexed with dgt, mg, zn

Details for d2e2ic2

PDB Entry: 2e2i (more details), 3.41 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dGTP
PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d2e2ic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2ic2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

SCOPe Domain Coordinates for d2e2ic2:

Click to download the PDB-style file with coordinates for d2e2ic2.
(The format of our PDB-style files is described here.)

Timeline for d2e2ic2: