SCOP 1.73: Domain d2e2ic2: 2e2i C:42-172

Lineage for d2e2ic2 (2e2i C:42-172)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)

6. Protein RPB3 [64462] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)

8. Domain d2e2ic2: 2e2i C:42-172 [131997]
   Other proteins in same PDB: d2e2ia1, d2e2ib1, d2e2ic1, d2e2ie1, d2e2ie2, d2e2if1, d2e2ih1, d2e2ii1, d2e2ii2, d2e2ij1, d2e2ik1, d2e2il1
   automatically matched to d1i3qc2
   complexed with dgt, mg, zn

Details for d2e2ic2

PDB Entry: 2e2i, 3.41 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dGTP

PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOP Domain Sequences for d2e2ic2:

Sequence; same for both SEQRES and ATOM records:

>d2e2ic2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

Timeline for d2e2ic2:

• d2e2ic2 is new in SCOP 1.73
  
• d2e2ic2 appears in SCOP 1.75
  
• d2e2ic2 appears in the current release, SCOPe 2.08