Lineage for d2e2ia1 (2e2i A:3-1449)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249905Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2249906Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2249995Family e.29.1.2: RNA-polymerase beta-prime [64490] (3 proteins)
  6. 2249996Protein RBP1 [64486] (2 species)
  7. 2249997Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64487] (24 PDB entries)
    Uniprot P04050; part of multichain biological unit
  8. 2250009Domain d2e2ia1: 2e2i A:3-1449 [131994]
    Other proteins in same PDB: d2e2ib1, d2e2ic1, d2e2ic2, d2e2ie1, d2e2ie2, d2e2if1, d2e2ih1, d2e2ii1, d2e2ii2, d2e2ij1, d2e2ik1, d2e2il1
    automatically matched to d1i50a_
    protein/DNA complex; protein/RNA complex; complexed with dgt, mg, zn

Details for d2e2ia1

PDB Entry: 2e2i (more details), 3.41 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dGTP
PDB Compounds: (A:) DNA-directed RNA polymerase II largest subunit

SCOPe Domain Sequences for d2e2ia1:

Sequence, based on SEQRES records: (download)

>d2e2ia1 e.29.1.2 (A:3-1449) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsid
rnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnelm
rqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglklv
gswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvp
pppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhvat
ymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnleld
qvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskrag
diqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynadf
dgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfie
ldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspkd
ngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhngf
stgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrfl
neardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdr
tlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrlv
kaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdll
ntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnirr
iiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccll
rsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtln
tfhfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaiehtt
lksvtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldraam
ndkdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhmlkk
ientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpgi
dptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqgglt
svtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtgafd
vmidees

Sequence, based on observed residues (ATOM records): (download)

>d2e2ia1 e.29.1.2 (A:3-1449) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsid
rnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnelm
rqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglklv
gswkkdratelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvppppvrp
sisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhvatymdndi
agqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnleldqvgvpk
siaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskragdiqlqy
gwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynadfdgdemn
lhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfieldqvln
mlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspkdngmlii
dgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhngfstgigd
tiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrflneardk
agrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdrtlphfs
kddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrlvkaledi
mvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdllntdhtl
dpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnirriiqnaq
qtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccllrsrlat
rrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtlkkvtsgv
prlkeilnvaknmktpsltvylepghaadqeqaklirsaiehttlksvtiaseiyydpdp
rstvipedeeiiqlhfslqqspwllrleldraamndkdltmgqvgerikqtfkndlfviw
sedndekliircrvvaeedhmlkkientmlenitlrgveniervvmmkydrkvpsptgey
vkepewvletdgvnlsevmtvpgidptriytnsfidimevlgieagraalykevynvias
dgsyvnyrhmallvdvmttqggltsvtrhgfnrsntgalmrcsfeetveilfeagasael
ddcrgvsenvilgqmapigtgafdvmidees

SCOPe Domain Coordinates for d2e2ia1:

Click to download the PDB-style file with coordinates for d2e2ia1.
(The format of our PDB-style files is described here.)

Timeline for d2e2ia1: